HORDB

ID: hor007072
Uniprot ID: P56413??86-134)
Protein name: Agouti-related protein
Gene name: ins-7
Organism: Bos taurus
Family: NA
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine)
GO MF: GO:0005615 extracellular space; GO:0005796 Golgi lumen
GO BP: GO:0031782 type 4 melanocortin receptor binding; GO:0031781 type 3 melanocortin receptor binding; GO:0070996 type 1 melanocortin receptor binding; GO:0005184 neuropeptide hormone activity
GO CC: GO:0008343 adult feeding behavior; GO:2000253 positive regulation of feeding behavior; GO:0007218 neuropeptide signaling pathway; GO:0060259 regulation of feeding behavior; GO:0009755 hormone-mediated signaling pathway

Sequence: PRRCVRLHESCLGHQVPCCDPCATCYCRFFNAFCYCRKLGTTTNPCSRT
Length: 49
Propeptide: MLTAVLLSCALLLAMPPLQGAQMGPAPLEGIGRPEEALFLELQGLSLQPSLKRITEEQAEESLLQEAEAKALAEVLDPEGRKPRSPRRCVRLHESCLGHQVPCCDPCATCYCRFFNAFCYCRKLGTTTNPCSRT
Signal peptide: MLTAVLLSCALLLAMPPLQG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: